PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g087840.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 310aa    MW: 35289.3 Da    PI: 6.574
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g087840.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.8e-1895148356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Sopim02g087840.0.1  95 KKRRLNMEQVKALERSFEVANKLEPERKIQLARALGLQPRQIAIWFQNRRARWK 148
                         456899***********************************************9 PP

2HD-ZIP_I/II130.85.3e-4294185192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ eqvk+LE+sFe  +kLeperK +lar+Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lkr++d+lk++n++L+++++eL++el
  Sopim02g087840.0.1  94 EKKRRLNMEQVKALERSFEVANKLEPERKIQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYEMLKRHFDSLKTDNDALKAQNKELHSEL 184
                         69***************************************************************************************99 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Sopim02g087840.0.1 185 Q 185
                         7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.6E-1893154IPR001356Homeobox domain
SuperFamilySSF466891.07E-1893152IPR009057Homeodomain-like
PROSITE profilePS5007116.56894150IPR001356Homeobox domain
CDDcd000861.65E-1695151No hitNo description
PfamPF000462.4E-1595148IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.1E-1997158IPR009057Homeodomain-like
PRINTSPR000311.9E-5121130IPR000047Helix-turn-helix motif
PROSITE patternPS000270125148IPR017970Homeobox, conserved site
PRINTSPR000311.9E-5130146IPR000047Helix-turn-helix motif
CDDcd146860.00598141185No hitNo description
PfamPF021839.1E-15150191IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MISGSRGIMD FLPSTPDISL NFQDNNHHLP STSPKLFPSP SIPHQDHFNH GVPSMLMRRS  60
MSFSGVERCD NHQDLRVDDN ELSDEDGSSQ LLGEKKRRLN MEQVKALERS FEVANKLEPE  120
RKIQLARALG LQPRQIAIWF QNRRARWKTK QLEKDYEMLK RHFDSLKTDN DALKAQNKEL  180
HSELQLLSVK KRESSGGGGI MFNLNKENEG CWSNNGSDDN NNNNSIDVNL GTRTSSGDSP  240
FYSKNVFPPE PGPVPLAQFL QTSSTPPDHL THCHKNIDPT VQNEGFCNMF TPVDDHTNFW  300
PWPEQQHFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142150RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0129220.0BT012922.1 Lycopersicon esculentum clone 114085R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232228.20.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ004661e-70HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLK4BBU00.0K4BBU0_SOLLC; Uncharacterized protein
STRINGSolyc02g087840.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.18e-66HD-ZIP family protein